(data stored in ACNUC7421 zone)

EMBL: CP000489.PE335

CP000489.PE335       Location/Qualifiers
FT   CDS             complement(320717..321160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68452"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYV8"
FT                   /protein_id="ABL68452.1"
FT                   /translation="MQVNRYLEDKAMDRIDHALGRPVNPLAQTYRDHFAASVGSRAAEE
FT                   MAASPHWRAGGSDGKLQWFFVTRAGQEALRDHLRKIGDQHRLYVVIWDGMEMPCVATSP
FT                   SKARYSKWLDVTDGFCEVSFKDFCRAARVRLAVGGGGAAEGWA"
     MQVNRYLEDK AMDRIDHALG RPVNPLAQTY RDHFAASVGS RAAEEMAASP HWRAGGSDGK        60
     LQWFFVTRAG QEALRDHLRK IGDQHRLYVV IWDGMEMPCV ATSPSKARYS KWLDVTDGFC       120
     EVSFKDFCRA ARVRLAVGGG GAAEGWA                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page