(data stored in ACNUC7421 zone)

EMBL: CP000489.PE336

CP000489.PE336       Location/Qualifiers
FT   CDS             complement(321356..322261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0339"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_3428 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68453"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYV9"
FT                   /protein_id="ABL68453.1"
FT                   /translation="MTSDIVSVEIGRSTWQGPAEEAPQRAEPITQGDLVSALEQIEILT
FT                   ATGSGLDPDTTMHIHLLAGIGRATHDPYAWYSRADLCASGQQVRALMDAAQTILDRGYV
FT                   SQSIAEEKPDHDALRDALAALTPAPQPEGPPDDLAVDRFAAAMKAKLAKKRTEGRGGWD
FT                   RKDECSAELLSRLLREHVEKGDPVDVGNLAMMLHQRGERIVPGGEAKSIAPQPEGEAVP
FT                   KCVACEDSPKPPNVPCAVCGAHPAQPGETVAAVERAFADIRELNMLDRDENGHRWANSD
FT                   LIDQTVTSGLIALRALKGGA"
     MTSDIVSVEI GRSTWQGPAE EAPQRAEPIT QGDLVSALEQ IEILTATGSG LDPDTTMHIH        60
     LLAGIGRATH DPYAWYSRAD LCASGQQVRA LMDAAQTILD RGYVSQSIAE EKPDHDALRD       120
     ALAALTPAPQ PEGPPDDLAV DRFAAAMKAK LAKKRTEGRG GWDRKDECSA ELLSRLLREH       180
     VEKGDPVDVG NLAMMLHQRG ERIVPGGEAK SIAPQPEGEA VPKCVACEDS PKPPNVPCAV       240
     CGAHPAQPGE TVAAVERAFA DIRELNMLDR DENGHRWANS DLIDQTVTSG LIALRALKGG       300
     A                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page