(data stored in ACNUC7421 zone)

EMBL: CP000489.PE337

CP000489.PE337       Location/Qualifiers
FT   CDS             complement(322258..322677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68454"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYW0"
FT                   /protein_id="ABL68454.1"
FT                   /translation="MKTIEQLTASETAWYSSNDTEVWHGGPYATREEAEDGAKAEEHEW
FT                   IMRATKWPVRVSEFFSQGCFFEAAEESLYDQCDEDGSPILDFTPAINLDLQSRVRAAID
FT                   EWQVAHQLSPMPWRFSGSDEPEIAAWAKAAEGGDA"
     MKTIEQLTAS ETAWYSSNDT EVWHGGPYAT REEAEDGAKA EEHEWIMRAT KWPVRVSEFF        60
     SQGCFFEAAE ESLYDQCDED GSPILDFTPA INLDLQSRVR AAIDEWQVAH QLSPMPWRFS       120
     GSDEPEIAAW AKAAEGGDA                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page