(data stored in ACNUC7421 zone)

EMBL: CP000489.PE338

CP000489.PE338       Location/Qualifiers
FT   CDS             complement(322674..325319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0341"
FT                   /product="DNA methylase N-4/N-6 domain protein"
FT                   /note="PFAM: DNA methylase N-4/N-6 domain protein; KEGG:
FT                   mes:Meso_1199 helicase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68455"
FT                   /db_xref="GOA:A1AYW1"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYW1"
FT                   /protein_id="ABL68455.1"
FT                   /translation="MGQHPSYDEFLRAKAAIAPRFGGMQVDEATLNPALKPHTRRMVSW
FT                   GLQGGRRAWFASFGLHKTATQLETMRVLTETTGQPTLITAPLGVRREFMREAQERFRGS
FT                   FAVDLKFIRDSDQVDGPGIYLTNYESVRDGKVQPDPFIGVSLDEAAILRGFGGTKTFRE
FT                   FMALFAGDDRRDQSNRIKTAGVPYRFVATATPSPNDYIELLSYAGFLDVMDIGQAKTRF
FT                   FKRNSEKADQLTLMQHKEREFWLWVASWALFVTKPSDLDPSFSDEGYDLPPLDVRWHEL
FT                   PVDHLAGAAVEKSGQKRMFKDVARDLKVAAREKRTSIGGRIEKLMEIRAEDPAAHRIIW
FT                   HDLEAERAALEKTVPGIATVYGSQDLDQREELIGDFADGRVQELGAKPVMLGSGTNLQR
FT                   HCAWHVFLGIGHKFNDFIQAIHRLLRFGQPADSVRLDLIYTEAEREIRRSLERKWRQHN
FT                   EMVQKMIDIIKEFGLSEVAMQQALVRALGVERVEASGPDYRCVHNDCVAETRSMPDASV
FT                   QLIVTSIPFSTQYEYSPNYADFGHTDDDPHFWQQMGFLIPELLRVLEPGRICAIHVKDR
FT                   IIPGGINGFGFQTLSTLHMDCVREFQRHGWAYLGMKTITTDVVRENNQTYRLGWSEQCK
FT                   DGSRMGCGVPEYLLIFRRPPSDTSNGYADRPVKKAKKEWDPEAKDWRNEGGYSRARWQI
FT                   DAHGYMRSNGDRTLLPEELEGLDADQVYKVWKAYNLQQVYDFEHHVRIGEALEKKGRLP
FT                   PTFMLLPPHSAHPDVWTDVARMMTINAEQARKGNEMHLCPLQYDIVDRAIAQFTERGEW
FT                   VYDPFGGLMTVPFRAVKLGRKGIGVELNKGYWLDGCKYVEAASREAGMPSLFDLLDADQ
FT                   PENQKLRRTA"
     MGQHPSYDEF LRAKAAIAPR FGGMQVDEAT LNPALKPHTR RMVSWGLQGG RRAWFASFGL        60
     HKTATQLETM RVLTETTGQP TLITAPLGVR REFMREAQER FRGSFAVDLK FIRDSDQVDG       120
     PGIYLTNYES VRDGKVQPDP FIGVSLDEAA ILRGFGGTKT FREFMALFAG DDRRDQSNRI       180
     KTAGVPYRFV ATATPSPNDY IELLSYAGFL DVMDIGQAKT RFFKRNSEKA DQLTLMQHKE       240
     REFWLWVASW ALFVTKPSDL DPSFSDEGYD LPPLDVRWHE LPVDHLAGAA VEKSGQKRMF       300
     KDVARDLKVA AREKRTSIGG RIEKLMEIRA EDPAAHRIIW HDLEAERAAL EKTVPGIATV       360
     YGSQDLDQRE ELIGDFADGR VQELGAKPVM LGSGTNLQRH CAWHVFLGIG HKFNDFIQAI       420
     HRLLRFGQPA DSVRLDLIYT EAEREIRRSL ERKWRQHNEM VQKMIDIIKE FGLSEVAMQQ       480
     ALVRALGVER VEASGPDYRC VHNDCVAETR SMPDASVQLI VTSIPFSTQY EYSPNYADFG       540
     HTDDDPHFWQ QMGFLIPELL RVLEPGRICA IHVKDRIIPG GINGFGFQTL STLHMDCVRE       600
     FQRHGWAYLG MKTITTDVVR ENNQTYRLGW SEQCKDGSRM GCGVPEYLLI FRRPPSDTSN       660
     GYADRPVKKA KKEWDPEAKD WRNEGGYSRA RWQIDAHGYM RSNGDRTLLP EELEGLDADQ       720
     VYKVWKAYNL QQVYDFEHHV RIGEALEKKG RLPPTFMLLP PHSAHPDVWT DVARMMTINA       780
     EQARKGNEMH LCPLQYDIVD RAIAQFTERG EWVYDPFGGL MTVPFRAVKL GRKGIGVELN       840
     KGYWLDGCKY VEAASREAGM PSLFDLLDAD QPENQKLRRT A                           881
//

If you have problems or comments...

PBIL Back to PBIL home page