(data stored in ACNUC7421 zone)

EMBL: CP000489.PE342

CP000489.PE342       Location/Qualifiers
FT   CDS             328067..328573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68459"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYW5"
FT                   /protein_id="ABL68459.1"
FT                   /translation="MLSLTADCSPGWITAASVCLGPWTAFAPTCPLIRSAAISVSFLLN
FT                   PPPRRHNPKSILMSLICKIPDRPRSGLPSRQMSFTPPVGGRGRSVAARRRAHVHAQRDT
FT                   DGFLRRWSMLMIVSFSTAEACGQHFGVTKQTGCNWREGTHRPCGDAVDFAMQTLPRYAE
FT                   IMWGQ"
     MLSLTADCSP GWITAASVCL GPWTAFAPTC PLIRSAAISV SFLLNPPPRR HNPKSILMSL        60
     ICKIPDRPRS GLPSRQMSFT PPVGGRGRSV AARRRAHVHA QRDTDGFLRR WSMLMIVSFS       120
     TAEACGQHFG VTKQTGCNWR EGTHRPCGDA VDFAMQTLPR YAEIMWGQ                    168
//

If you have problems or comments...

PBIL Back to PBIL home page