(data stored in ACNUC7421 zone)

EMBL: CP000489.PE343

CP000489.PE343       Location/Qualifiers
FT   CDS             328573..329100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0346"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68460"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYW6"
FT                   /protein_id="ABL68460.1"
FT                   /translation="MDEPDLKPLMGARLARTSEVIERGNAMTAQDTDNWAADEAAERDP
FT                   SDDLGRLFPREGVQHPISESAAWALCAPFVGLVRCNWRVKRVDTDLFEQAIKTWWECLR
FT                   KARLPEERLTCERMINALGLANGMDNRARASELAAENVERFMAHRKEMARVRSERKEAA
FT                   CVDAWRDFRSVP"
     MDEPDLKPLM GARLARTSEV IERGNAMTAQ DTDNWAADEA AERDPSDDLG RLFPREGVQH        60
     PISESAAWAL CAPFVGLVRC NWRVKRVDTD LFEQAIKTWW ECLRKARLPE ERLTCERMIN       120
     ALGLANGMDN RARASELAAE NVERFMAHRK EMARVRSERK EAACVDAWRD FRSVP            175
//

If you have problems or comments...

PBIL Back to PBIL home page