(data stored in ACNUC7421 zone)

EMBL: CP000489.PE345

CP000489.PE345       Location/Qualifiers
FT   CDS             329665..329997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0348"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68462"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYW8"
FT                   /protein_id="ABL68462.1"
FT                   /translation="MHAHPRDLKSNTAARLMSIAAIRARLSMLAVAYAARIGAVNMNDV
FT                   LATASAVVAVFGEDHDLSREMRGFVDSLPELRRHVPDLASAGDRLIRAVERTTWPDADG
FT                   RADIHG"
     MHAHPRDLKS NTAARLMSIA AIRARLSMLA VAYAARIGAV NMNDVLATAS AVVAVFGEDH        60
     DLSREMRGFV DSLPELRRHV PDLASAGDRL IRAVERTTWP DADGRADIHG                  110
//

If you have problems or comments...

PBIL Back to PBIL home page