(data stored in ACNUC7421 zone)

EMBL: CP000489.PE346

CP000489.PE346       Location/Qualifiers
FT   CDS             329990..330304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68463"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYW9"
FT                   /protein_id="ABL68463.1"
FT                   /translation="MADQPRLSLADHAMIHALGVLSRPPITDRAGLDLVVGVMRDLMPG
FT                   VTRENPQLMGLIQTADQFATCRVAVPGCYGGLHDRAWKVMNDWDRRRLAEAWDRARGAK
FT                   "
     MADQPRLSLA DHAMIHALGV LSRPPITDRA GLDLVVGVMR DLMPGVTREN PQLMGLIQTA        60
     DQFATCRVAV PGCYGGLHDR AWKVMNDWDR RRLAEAWDRA RGAK                        104
//

If you have problems or comments...

PBIL Back to PBIL home page