(data stored in ACNUC7421 zone)

EMBL: CP000489.PE35

CP000489.PE35        Location/Qualifiers
FT   CDS             complement(28793..29467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0035"
FT                   /product="transcriptional activator, TenA family"
FT                   /note="PFAM: TENA/THI-4 domain protein; KEGG: rde:RD1_3613
FT                   transcriptional regulator, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68152"
FT                   /db_xref="GOA:A1AY08"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY08"
FT                   /protein_id="ABL68152.1"
FT                   /translation="MNRYGHAFAAWRAEAQPDWDAYTRHPFVEGLRDGTLPQSRFLTYL
FT                   VQDYLFLKNFSRAWALAVVKAGDLDEMRACSATVHTLLDHEMSLHVQTCARAGMGPEVL
FT                   ADAQEAVTNIAYTRYVLEAGYSGDFLDLLAALMPCVIGYGEIGLRLATEATPDTPYREW
FT                   IDTYAGAEYQAACVSAGALLDSAIRKRLGEAPEKSPRWAALSDRFATATRLEVAFWELG
FT                   RE"
     MNRYGHAFAA WRAEAQPDWD AYTRHPFVEG LRDGTLPQSR FLTYLVQDYL FLKNFSRAWA        60
     LAVVKAGDLD EMRACSATVH TLLDHEMSLH VQTCARAGMG PEVLADAQEA VTNIAYTRYV       120
     LEAGYSGDFL DLLAALMPCV IGYGEIGLRL ATEATPDTPY REWIDTYAGA EYQAACVSAG       180
     ALLDSAIRKR LGEAPEKSPR WAALSDRFAT ATRLEVAFWE LGRE                        224
//

If you have problems or comments...

PBIL Back to PBIL home page