(data stored in ACNUC7421 zone)

EMBL: CP000489.PE351

CP000489.PE351       Location/Qualifiers
FT   CDS             complement(334153..334449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0354"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68468"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYX4"
FT                   /protein_id="ABL68468.1"
FT                   /translation="MLRSFVFKGLTLFFGPDGLEGLENLTFTHEAFPPYPAVSRACVHV
FT                   DFSGPSGPSGPKIGIKPLILRKRHPLTPEGFQAHHRRPSGPSGPTTMRWHKDA"
     MLRSFVFKGL TLFFGPDGLE GLENLTFTHE AFPPYPAVSR ACVHVDFSGP SGPSGPKIGI        60
     KPLILRKRHP LTPEGFQAHH RRPSGPSGPT TMRWHKDA                                98
//

If you have problems or comments...

PBIL Back to PBIL home page