(data stored in ACNUC7421 zone)

EMBL: CP000489.PE353

CP000489.PE353       Location/Qualifiers
FT   CDS             335488..335838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0356"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   rsp:RSP_2072 putative phage-related holin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68470"
FT                   /db_xref="GOA:A1AYX6"
FT                   /db_xref="InterPro:IPR002711"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYX6"
FT                   /protein_id="ABL68470.1"
FT                   /translation="MSRLGRMPSRFAGADQAGQRLSRAFQHRDQQREAIAPWRRWYKTA
FT                   RWQRLRESVLIRDQFTCRKCGTIETDTSMLVGDHIVPHRGDPELFWSQANVQCLCKTCH
FT                   DRDKQAEERNHV"
     MSRLGRMPSR FAGADQAGQR LSRAFQHRDQ QREAIAPWRR WYKTARWQRL RESVLIRDQF        60
     TCRKCGTIET DTSMLVGDHI VPHRGDPELF WSQANVQCLC KTCHDRDKQA EERNHV           116
//

If you have problems or comments...

PBIL Back to PBIL home page