(data stored in ACNUC7421 zone)

EMBL: CP000489.PE354

CP000489.PE354       Location/Qualifiers
FT   CDS             335888..336148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68471"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYX7"
FT                   /protein_id="ABL68471.1"
FT                   /translation="MDALPAGGSILVVMTWDRARIYREGIVIRRGAEIEARTVVVSMGA
FT                   KDIISRLTGALLPIIITADVRAYCPRPLLLRIEDLAARPLN"
     MDALPAGGSI LVVMTWDRAR IYREGIVIRR GAEIEARTVV VSMGAKDIIS RLTGALLPII        60
     ITADVRAYCP RPLLLRIEDL AARPLN                                             86
//

If you have problems or comments...

PBIL Back to PBIL home page