(data stored in ACNUC7421 zone)

EMBL: CP000489.PE359

CP000489.PE359       Location/Qualifiers
FT   CDS             340714..342063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0362"
FT                   /product="phage major capsid protein, HK97 family"
FT                   /note="TIGRFAM: phage major capsid protein, HK97 family;
FT                   KEGG: rsp:RSP_2067 putative prophage LambdaSo, major capsid
FT                   protein, HK97 family"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68476"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYY2"
FT                   /protein_id="ABL68476.1"
FT                   /translation="MNKALMPQASLAALMAARPQAVIGAVRSEANPGNVEQLMREVRQE
FT                   LDRIGGDVKRTAEDALRQSRDTGELTRELKNSADQLLTQQKILTDAQQKLTDRLEQLET
FT                   RNTDLEQQLSQRGRGNRDQVQSFGERAARHDDMRAFAQAGCKGTVRIALDVEQAITSVR
FT                   PGGGGLIWSDRETEIVGLPRRQMTIRNLLSQGRTGSNAIEYARQTTRTNNARPVTEGAQ
FT                   KPESDYVWAQESALVRTIAHFVHVSRQAMEDAQQLQTEIDTELRYGLMLAEEGQLLKGD
FT                   GVGQNLEGLVTAATAFVPAFAVAGETMIDTLRLALLQASLAEYPADGIVLHPTNWAQIE
FT                   LTKDGEFRYIFANVMQLAGPQLWGHPVVQTQSMDLDEFLTGAFKAAATIYDRMDPEVIA
FT                   SSEDRDNFIKNMITVRAEERLALAIKRPAALITGEFNSTVVSSGAPVSSA"
     MNKALMPQAS LAALMAARPQ AVIGAVRSEA NPGNVEQLMR EVRQELDRIG GDVKRTAEDA        60
     LRQSRDTGEL TRELKNSADQ LLTQQKILTD AQQKLTDRLE QLETRNTDLE QQLSQRGRGN       120
     RDQVQSFGER AARHDDMRAF AQAGCKGTVR IALDVEQAIT SVRPGGGGLI WSDRETEIVG       180
     LPRRQMTIRN LLSQGRTGSN AIEYARQTTR TNNARPVTEG AQKPESDYVW AQESALVRTI       240
     AHFVHVSRQA MEDAQQLQTE IDTELRYGLM LAEEGQLLKG DGVGQNLEGL VTAATAFVPA       300
     FAVAGETMID TLRLALLQAS LAEYPADGIV LHPTNWAQIE LTKDGEFRYI FANVMQLAGP       360
     QLWGHPVVQT QSMDLDEFLT GAFKAAATIY DRMDPEVIAS SEDRDNFIKN MITVRAEERL       420
     ALAIKRPAAL ITGEFNSTVV SSGAPVSSA                                         449
//

If you have problems or comments...

PBIL Back to PBIL home page