(data stored in ACNUC7421 zone)

EMBL: CP000489.PE360

CP000489.PE360       Location/Qualifiers
FT   CDS             342121..342429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68477"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYY3"
FT                   /protein_id="ABL68477.1"
FT                   /translation="MKIQALRGMVGSYGALRRGQVADIDDHIAEKLVKAGRAVPVETDA
FT                   ADPIPASEPGPVSGADAKDTRQAGGRAGKAKPASSSPADPAPETSGQVSPPSEGNPA"
     MKIQALRGMV GSYGALRRGQ VADIDDHIAE KLVKAGRAVP VETDAADPIP ASEPGPVSGA        60
     DAKDTRQAGG RAGKAKPASS SPADPAPETS GQVSPPSEGN PA                          102
//

If you have problems or comments...

PBIL Back to PBIL home page