(data stored in ACNUC7421 zone)

EMBL: CP000489.PE364

CP000489.PE364       Location/Qualifiers
FT   CDS             343922..344218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0367"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68481"
FT                   /db_xref="InterPro:IPR021508"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYY7"
FT                   /protein_id="ABL68481.1"
FT                   /translation="MKSTPYPYATLGPSYWVDDISECILARDVTLQIDLWDSQVNKGRL
FT                   EDLTDDVATALRGWSDTDALTMHPMRVTLARVMDDPDGVSVHGVVQVEALVEG"
     MKSTPYPYAT LGPSYWVDDI SECILARDVT LQIDLWDSQV NKGRLEDLTD DVATALRGWS        60
     DTDALTMHPM RVTLARVMDD PDGVSVHGVV QVEALVEG                                98
//

If you have problems or comments...

PBIL Back to PBIL home page