(data stored in ACNUC7421 zone)

EMBL: CP000489.PE365

CP000489.PE365       Location/Qualifiers
FT   CDS             complement(344215..344742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0368"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68482"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYY8"
FT                   /protein_id="ABL68482.1"
FT                   /translation="MLGEGRADEVADVFADLLGPLLHRLTGCLYSDIRNSLEFCHDPGV
FT                   KLGHGSPIYEDYMRHFTAVLLATLAAPPLATASELECLVIRTHIEKMQDASFAAIYSTE
FT                   AGAQDVKDAVNKILIDPRMPADLADEGRKHIFGDAFDRWETTYKEARYSAQYPEDPAFE
FT                   ALMREKCGRNWR"
     MLGEGRADEV ADVFADLLGP LLHRLTGCLY SDIRNSLEFC HDPGVKLGHG SPIYEDYMRH        60
     FTAVLLATLA APPLATASEL ECLVIRTHIE KMQDASFAAI YSTEAGAQDV KDAVNKILID       120
     PRMPADLADE GRKHIFGDAF DRWETTYKEA RYSAQYPEDP AFEALMREKC GRNWR            175
//

If you have problems or comments...

PBIL Back to PBIL home page