(data stored in ACNUC7421 zone)

EMBL: CP000489.PE369

CP000489.PE369       Location/Qualifiers
FT   CDS             346245..349151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0372"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_3791 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68486"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR034691"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYZ2"
FT                   /protein_id="ABL68486.1"
FT                   /translation="MANEPDLLISAGFSDAQLVKEADKVVEFYRKKGQEAQKAFQDSQG
FT                   RVTNTQAARAHARELDRLAKSYDPVYRAAKRYEEELKRLDKALDVGAISQKRYADLVGQ
FT                   AARQMNLATGAIEQSSRKAAGGGNMLQQVGWQVGDFAVQVGAGTSAAQAFAQQAPQLLG
FT                   AMGAWGALAGAGVAVAVPLGAALLKVAMDTETLAEKLDSLNDTTKAYTDAAEAAVEPIS
FT                   VLRQKYGELADEVQRANGTMAMLASIRAQSDLFGAARSLGRELGINLNPMDVPLQADGA
FT                   INRDREYMAIQQRERAMERLRQRTGATADQADRLRMALNRTDSSNSLEAVVQDAANLLR
FT                   IIAELSGNEGADTMFLGGWAQQVDAVMKSAQKQIEATNKAQNDLLNSYDENTQKLKKLA
FT                   DDRRLAEEMLAVALKDGKADQIEAYGRVIKAIDKEVQAVKQSIAEMDGTFEASVKRMQE
FT                   LAGGLGGTINDAIKQWTGLNLREWGQAGAAANKGILDLIAQRESRGDYNATLDDGRWTG
FT                   GSRNLVNMTLKEIRALQEAMKTPENRALYGNGAGSSALGRYQIVGTTLDDLMKRLKLTG
FT                   DELFTPELQDRLATELLRQIKPGDVEGIRKVWAGLENVPAPLIQQAWGQQSIPRVDAEI
FT                   QKDLDKEIKDRERLAEQARRYGEQLAQNLLTEKESARLAAEQADQISAIKAQGLAPEDE
FT                   SRAIAAVTADIESQRVVLTLLADAKRRNVDLDAMLADGSMTYKQAIEALGEAKKADIIA
FT                   TNERAIAEGRLAETQQLMADAQQQTKQGLLDSIVAGESFADVLANVARMFAKAALEAAL
FT                   FNEGSWASGGGGKGLLGGLVNAIFKGWSVGGYTGPGGKHEPAGIVHKGEVVWSQDDVRR
FT                   AGGVGVVEALRRSSRLPGLADGGAAGMPMMQLSQIPFGLAAQRGPAVNATFAPNISIAP
FT                   GVTQAELAMTMAAAQREYEQKFLPMLQKHMPSYNERYT"
     MANEPDLLIS AGFSDAQLVK EADKVVEFYR KKGQEAQKAF QDSQGRVTNT QAARAHAREL        60
     DRLAKSYDPV YRAAKRYEEE LKRLDKALDV GAISQKRYAD LVGQAARQMN LATGAIEQSS       120
     RKAAGGGNML QQVGWQVGDF AVQVGAGTSA AQAFAQQAPQ LLGAMGAWGA LAGAGVAVAV       180
     PLGAALLKVA MDTETLAEKL DSLNDTTKAY TDAAEAAVEP ISVLRQKYGE LADEVQRANG       240
     TMAMLASIRA QSDLFGAARS LGRELGINLN PMDVPLQADG AINRDREYMA IQQRERAMER       300
     LRQRTGATAD QADRLRMALN RTDSSNSLEA VVQDAANLLR IIAELSGNEG ADTMFLGGWA       360
     QQVDAVMKSA QKQIEATNKA QNDLLNSYDE NTQKLKKLAD DRRLAEEMLA VALKDGKADQ       420
     IEAYGRVIKA IDKEVQAVKQ SIAEMDGTFE ASVKRMQELA GGLGGTINDA IKQWTGLNLR       480
     EWGQAGAAAN KGILDLIAQR ESRGDYNATL DDGRWTGGSR NLVNMTLKEI RALQEAMKTP       540
     ENRALYGNGA GSSALGRYQI VGTTLDDLMK RLKLTGDELF TPELQDRLAT ELLRQIKPGD       600
     VEGIRKVWAG LENVPAPLIQ QAWGQQSIPR VDAEIQKDLD KEIKDRERLA EQARRYGEQL       660
     AQNLLTEKES ARLAAEQADQ ISAIKAQGLA PEDESRAIAA VTADIESQRV VLTLLADAKR       720
     RNVDLDAMLA DGSMTYKQAI EALGEAKKAD IIATNERAIA EGRLAETQQL MADAQQQTKQ       780
     GLLDSIVAGE SFADVLANVA RMFAKAALEA ALFNEGSWAS GGGGKGLLGG LVNAIFKGWS       840
     VGGYTGPGGK HEPAGIVHKG EVVWSQDDVR RAGGVGVVEA LRRSSRLPGL ADGGAAGMPM       900
     MQLSQIPFGL AAQRGPAVNA TFAPNISIAP GVTQAELAMT MAAAQREYEQ KFLPMLQKHM       960
     PSYNERYT                                                                968
//

If you have problems or comments...

PBIL Back to PBIL home page