(data stored in ACNUC7421 zone)

EMBL: CP000489.PE370

CP000489.PE370       Location/Qualifiers
FT   CDS             349151..349831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0373"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68487"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYZ3"
FT                   /protein_id="ABL68487.1"
FT                   /translation="MPEVIAWPCSLIRPQDVSYFIQRTSRDAGANLAGIAQILTPGTGA
FT                   WRVDITIPRDFDGTRVKQLEALVSEMRGRENVANLCICDPYKYGSRVSPVQTPFSDGTW
FT                   FSDGTGFTDPAAGTQPLLTSAAVAAGDNELYVDLTNPVRPSLRIGDMFSVNGFLYRVVR
FT                   RNAAGWVKFEPSARRAIASGVALVTDPPRFYGRFIDDMQGQRTREMLKWGQSITISFIE
FT                   AFDR"
     MPEVIAWPCS LIRPQDVSYF IQRTSRDAGA NLAGIAQILT PGTGAWRVDI TIPRDFDGTR        60
     VKQLEALVSE MRGRENVANL CICDPYKYGS RVSPVQTPFS DGTWFSDGTG FTDPAAGTQP       120
     LLTSAAVAAG DNELYVDLTN PVRPSLRIGD MFSVNGFLYR VVRRNAAGWV KFEPSARRAI       180
     ASGVALVTDP PRFYGRFIDD MQGQRTREML KWGQSITISF IEAFDR                      226
//

If you have problems or comments...

PBIL Back to PBIL home page