(data stored in ACNUC7421 zone)

EMBL: CP000489.PE372

CP000489.PE372       Location/Qualifiers
FT   CDS             350379..350750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_1234 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68489"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYZ5"
FT                   /protein_id="ABL68489.1"
FT                   /translation="MADRLGAFVEATASRPWDWATDNCTFWVADWALMRWGADFAARYR
FT                   DRCRSEADAAALTAGGLVALVEPEIALPRKDAPAEGDIGVIEFRGRQVSAIWSGSHWLI
FT                   RTPRGVAMVRARAIAIWGD"
     MADRLGAFVE ATASRPWDWA TDNCTFWVAD WALMRWGADF AARYRDRCRS EADAAALTAG        60
     GLVALVEPEI ALPRKDAPAE GDIGVIEFRG RQVSAIWSGS HWLIRTPRGV AMVRARAIAI       120
     WGD                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page