(data stored in ACNUC7421 zone)

EMBL: CP000489.PE374

CP000489.PE374       Location/Qualifiers
FT   CDS             352856..354613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68491"
FT                   /db_xref="UniProtKB/TrEMBL:A1AYZ7"
FT                   /protein_id="ABL68491.1"
FT                   /translation="MSFQSDANEAYPNGTPVDKADVRALWGRVDGVVANGGKVFPARGD
FT                   AEAAGQSALVPALSRIFVTEGSYLHLRGPSSQALDPLFPSYPYWGIQFIVPNTTAAWNR
FT                   ANHTGTQPISTVDGLPEALDGKADQEVVNGLIADAEDQAEKLTFATAEGSPFDSHLTDS
FT                   RGDLLAGWAADRAALAGMDFLRNDGLDRPVVVGSDNFVLWYPPDAEPAQNPALTPYFGS
FT                   RLFGIAGERLPIYAAGLIANRADVEQVRLVLAGAAGEVGYGDRRVDVDAAGLGASAALQ
FT                   LRNRADAGGPFVELPLTVHAAPKAPGSGDAPVILSVGDSITHRSGTALAAVYLDEWGYT
FT                   PDFIGTLMSETGGDAPPVAGEGKPGHCLQDLTYDVTNRVQPLAPGDESLYNAMSTADKR
FT                   LRNTMLRAATGGDDPADVRNGYVLDFGFYITRHGLATPTVLWQGYGTNDIRDIPAGDIE
FT                   DRIHDMDSLVYRRWHAAYPSAPVVRWMPGTAWDADRNLVWTASYIPTIRGMLRAAAEAT
FT                   GPVLLVPTWAMHTPEAGYDLVPSPAIPDPVTGHIVRTIGDTIHPTGASRRELFRAVAAA
FT                   LACASTGNF"
     MSFQSDANEA YPNGTPVDKA DVRALWGRVD GVVANGGKVF PARGDAEAAG QSALVPALSR        60
     IFVTEGSYLH LRGPSSQALD PLFPSYPYWG IQFIVPNTTA AWNRANHTGT QPISTVDGLP       120
     EALDGKADQE VVNGLIADAE DQAEKLTFAT AEGSPFDSHL TDSRGDLLAG WAADRAALAG       180
     MDFLRNDGLD RPVVVGSDNF VLWYPPDAEP AQNPALTPYF GSRLFGIAGE RLPIYAAGLI       240
     ANRADVEQVR LVLAGAAGEV GYGDRRVDVD AAGLGASAAL QLRNRADAGG PFVELPLTVH       300
     AAPKAPGSGD APVILSVGDS ITHRSGTALA AVYLDEWGYT PDFIGTLMSE TGGDAPPVAG       360
     EGKPGHCLQD LTYDVTNRVQ PLAPGDESLY NAMSTADKRL RNTMLRAATG GDDPADVRNG       420
     YVLDFGFYIT RHGLATPTVL WQGYGTNDIR DIPAGDIEDR IHDMDSLVYR RWHAAYPSAP       480
     VVRWMPGTAW DADRNLVWTA SYIPTIRGML RAAAEATGPV LLVPTWAMHT PEAGYDLVPS       540
     PAIPDPVTGH IVRTIGDTIH PTGASRRELF RAVAAALACA STGNF                       585
//

If you have problems or comments...

PBIL Back to PBIL home page