(data stored in ACNUC7421 zone)

EMBL: CP000489.PE379

CP000489.PE379       Location/Qualifiers
FT   CDS             356648..357043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0382"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsp:RSP_6192 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68496"
FT                   /db_xref="GOA:A1AZ02"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ02"
FT                   /protein_id="ABL68496.1"
FT                   /translation="MQTIINAAAPHLLELIGLAITAIIGWGVRQASKRWGIEIQASHRE
FT                   ALHWALYTAAQLAIKHELTGKAAVDLVLEYARRSVPDAIGNLKPSAEVLTDLARAKLEQ
FT                   VAAEKAKDAATGAVDQLTEALRRAGAA"
     MQTIINAAAP HLLELIGLAI TAIIGWGVRQ ASKRWGIEIQ ASHREALHWA LYTAAQLAIK        60
     HELTGKAAVD LVLEYARRSV PDAIGNLKPS AEVLTDLARA KLEQVAAEKA KDAATGAVDQ       120
     LTEALRRAGA A                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page