(data stored in ACNUC7421 zone)

EMBL: CP000489.PE380

CP000489.PE380       Location/Qualifiers
FT   CDS             complement(357161..357364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68497"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ03"
FT                   /protein_id="ABL68497.1"
FT                   /translation="MTPEAFARWLAEMKAAGLAKSDRDAAALLGVSANSIVSMKRSGVT
FT                   GATAERTALACQALLDGLKPYQ"
     MTPEAFARWL AEMKAAGLAK SDRDAAALLG VSANSIVSMK RSGVTGATAE RTALACQALL        60
     DGLKPYQ                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page