(data stored in ACNUC7421 zone)

EMBL: CP000489.PE382

CP000489.PE382       Location/Qualifiers
FT   CDS             complement(358047..359285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0385"
FT                   /product="Recombinase"
FT                   /note="PFAM: Resolvase, N-terminal domain; Recombinase;
FT                   KEGG: nwi:Nwi_1951 resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68499"
FT                   /db_xref="GOA:A1AZ05"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ05"
FT                   /protein_id="ABL68499.1"
FT                   /translation="MRCAIYTRKSADERAGAEFGSLENQRSFCASYIASQGGQGWDELP
FT                   NRYDDEGYSGGSLKRPSLDRLRADIQLRKLDTVVVYKIDRLSRSLRDFCNLVAEFEACG
FT                   VTFVSVTQSFDTGTAMGRLTLNVLLSFAQFERELTGERLKDWFAGARERGLWVQQRPFG
FT                   YAKPPGTNQLVPHETEAPVVRWIFRRYIALKSAERVADDLYARGITNTRGKPWTGNMVR
FT                   HTITHPIYRGKMVHRRQAMPGSHEPIVSDSLWRRANAVLADARNHRMGGRGAKPLALLA
FT                   GLLFDRTGSAITHTFLTSKGRLYRYYIAQQERRHGYGEDSDPYMRFRAADLEAAVLEVV
FT                   QRMTGYDLGAVRAQYERIERLRTYIERIDVDLEGMTVVFRAGGSVRAEAAGRLGPRRHT
FT                   RREKRGRPQQGGK"
     MRCAIYTRKS ADERAGAEFG SLENQRSFCA SYIASQGGQG WDELPNRYDD EGYSGGSLKR        60
     PSLDRLRADI QLRKLDTVVV YKIDRLSRSL RDFCNLVAEF EACGVTFVSV TQSFDTGTAM       120
     GRLTLNVLLS FAQFERELTG ERLKDWFAGA RERGLWVQQR PFGYAKPPGT NQLVPHETEA       180
     PVVRWIFRRY IALKSAERVA DDLYARGITN TRGKPWTGNM VRHTITHPIY RGKMVHRRQA       240
     MPGSHEPIVS DSLWRRANAV LADARNHRMG GRGAKPLALL AGLLFDRTGS AITHTFLTSK       300
     GRLYRYYIAQ QERRHGYGED SDPYMRFRAA DLEAAVLEVV QRMTGYDLGA VRAQYERIER       360
     LRTYIERIDV DLEGMTVVFR AGGSVRAEAA GRLGPRRHTR REKRGRPQQG GK               412
//

If you have problems or comments...

PBIL Back to PBIL home page