(data stored in ACNUC7421 zone)

EMBL: CP000489.PE383

CP000489.PE383       Location/Qualifiers
FT   CDS             359492..360115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0386"
FT                   /product="protein of unknown function DUF159"
FT                   /note="PFAM: protein of unknown function DUF159; KEGG:
FT                   sit:TM1040_1580 protein of unknown function DUF159"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68500"
FT                   /db_xref="GOA:A1AZ06"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ06"
FT                   /protein_id="ABL68500.1"
FT                   /translation="MCGRFVDPNLRGTSFEISQTRLHPFPRRYNIKPTQDVLVITTDAP
FT                   EGEMARWWLVPSWHKGDLRDWKATTFNARIEDAASKPTFRGPWRYGRCLIPAGGYYEWT
FT                   GEKGHKQPHFISSAGNDDTLWFAGLVSRWNDMLTCTIVTRPANASVADIHTRMPVILNA
FT                   DERDAWLAGSDDPEIGAGAQLRHHPVARFGTASDGPELIDPTAA"
     MCGRFVDPNL RGTSFEISQT RLHPFPRRYN IKPTQDVLVI TTDAPEGEMA RWWLVPSWHK        60
     GDLRDWKATT FNARIEDAAS KPTFRGPWRY GRCLIPAGGY YEWTGEKGHK QPHFISSAGN       120
     DDTLWFAGLV SRWNDMLTCT IVTRPANASV ADIHTRMPVI LNADERDAWL AGSDDPEIGA       180
     GAQLRHHPVA RFGTASDGPE LIDPTAA                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page