(data stored in ACNUC7421 zone)

EMBL: CP000489.PE386

CP000489.PE386       Location/Qualifiers
FT   CDS             361152..361484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0389"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68503"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ09"
FT                   /protein_id="ABL68503.1"
FT                   /translation="MHQSLTGFLRSLESWSRTSCDAPWRHFCAATDSDANDARGLITQS
FT                   GRDYSAAPRTRAMWPGRWYAPWATTVTKASESTTCSGSSKVVPFCREQMWRVMSQMKVP
FT                   CPLSGR"
     MHQSLTGFLR SLESWSRTSC DAPWRHFCAA TDSDANDARG LITQSGRDYS AAPRTRAMWP        60
     GRWYAPWATT VTKASESTTC SGSSKVVPFC REQMWRVMSQ MKVPCPLSGR                  110
//

If you have problems or comments...

PBIL Back to PBIL home page