(data stored in ACNUC7421 zone)

EMBL: CP000489.PE39

CP000489.PE39        Location/Qualifiers
FT   CDS             complement(31984..32748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0039"
FT                   /product="thiazole-phosphate synthase"
FT                   /note="PFAM: thiazole biosynthesis family protein; KEGG:
FT                   rde:RD1_0749 thiazole biosynthesis protein ThiG"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68156"
FT                   /db_xref="GOA:A1AY12"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AY12"
FT                   /protein_id="ABL68156.1"
FT                   /translation="MPVFYGTRVESPLMLGTAQYPSPAIMAEAFRASRAGIATVSLRRE
FT                   GGAGQDFHRLIKDLGIPVLPNTAGCHSVREAVTTAQMARELFETPWLKLEVIRDDDTLC
FT                   PDVIALVEAARVLSDDGFQVFPYCTEDLSVCGRLLDAGCQVLMPWGAPIGSGRGLNNPY
FT                   GLRSLRAHFPDVPLVVDAGIGLPSHAAQAMELGYDAVLLNTAVAKAGDPVAMARAMALA
FT                   IEAGQLAHGANPIEARDMAAPSTPLFGMAVLG"
     MPVFYGTRVE SPLMLGTAQY PSPAIMAEAF RASRAGIATV SLRREGGAGQ DFHRLIKDLG        60
     IPVLPNTAGC HSVREAVTTA QMARELFETP WLKLEVIRDD DTLCPDVIAL VEAARVLSDD       120
     GFQVFPYCTE DLSVCGRLLD AGCQVLMPWG APIGSGRGLN NPYGLRSLRA HFPDVPLVVD       180
     AGIGLPSHAA QAMELGYDAV LLNTAVAKAG DPVAMARAMA LAIEAGQLAH GANPIEARDM       240
     AAPSTPLFGM AVLG                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page