(data stored in ACNUC7421 zone)

EMBL: CP000489.PE390

CP000489.PE390       Location/Qualifiers
FT   CDS             363233..363715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0393"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bms:BR0799 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68507"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ13"
FT                   /protein_id="ABL68507.1"
FT                   /translation="MTGKHCSPVIACPALLDFLAYARSLEGRWIMQNKAILIVGPLLFA
FT                   ACTASDNYSEIIARSTPPGAALKAEIVAGAKELIYDPASIRDAEISNVATLPDGLQGVC
FT                   VRADSKDVSGRYLGLHSIGIPIRDGKIAGGSLDHPLCDRADIQWQPFPELERLPGA"
     MTGKHCSPVI ACPALLDFLA YARSLEGRWI MQNKAILIVG PLLFAACTAS DNYSEIIARS        60
     TPPGAALKAE IVAGAKELIY DPASIRDAEI SNVATLPDGL QGVCVRADSK DVSGRYLGLH       120
     SIGIPIRDGK IAGGSLDHPL CDRADIQWQP FPELERLPGA                             160
//

If you have problems or comments...

PBIL Back to PBIL home page