(data stored in ACNUC7421 zone)

EMBL: CP000489.PE395

CP000489.PE395       Location/Qualifiers
FT   CDS             368315..368557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0398"
FT                   /product="Exodeoxyribonuclease VII small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /note="TIGRFAM: exodeoxyribonuclease VII, small subunit;
FT                   PFAM: Exonuclease VII, small subunit; KEGG: jan:Jann_0090
FT                   exodeoxyribonuclease VII, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68512"
FT                   /db_xref="GOA:A1AZ18"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ18"
FT                   /protein_id="ABL68512.1"
FT                   /translation="MTGTEIENMSFEEAMKELEATVGRLEHGEATLEESIKLYERGAAL
FT                   RAHCDKRLREAEERVEKITLAANGQPTGTVPAEGL"
     MTGTEIENMS FEEAMKELEA TVGRLEHGEA TLEESIKLYE RGAALRAHCD KRLREAEERV        60
     EKITLAANGQ PTGTVPAEGL                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page