(data stored in ACNUC7421 zone)

EMBL: CP000489.PE397

CP000489.PE397       Location/Qualifiers
FT   CDS             369446..371368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0400"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /note="TIGRFAM: deoxyxylulose-5-phosphate synthase; PFAM:
FT                   Transketolase, central region; Transketolase domain
FT                   protein; KEGG: sil:SPO0247 1-deoxy-D-xylulose-5-phosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68514"
FT                   /db_xref="GOA:A1AZ20"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ20"
FT                   /protein_id="ABL68514.1"
FT                   /translation="MTHETSDRPSTPILDRVHLPSDLKDLTDRELRQLADELRAETVSA
FT                   VSVTGGHLGAGLGVVELTVALHAVFDAPRDKIIWDVGHQCYPHKILTGRRDRIRTLRME
FT                   GGLSGFTKRSESPYDPFGAGHSSTSISAALGFAMARELGGDPGDAIAVIGDGAMSAGMA
FT                   FEALNNAGDLGKRLFVVLNDNEMSIAPPTGALSRYLTRLYAEGPFQDLKAVAKGAVGFL
FT                   PPTLQEGARRAKEMLKGMTVGGTLFEELGFSYIGPVDGHDLDQLLPLLRTVKARATGPV
FT                   LLHVVTRKGKGYGPAERAADKGHATAKFDVETGAQAKAKSNAPSYTSVFARALVDQASR
FT                   DARIVAVTAAMPDGTGLNLMAERFPRRCFDVGIAEQHAVTFSAGLAAGGMKPFCALYST
FT                   FLQRGYDQVVHDVAIQRLPVRFAIDRAGLVGADGATHAGAYDVAFLANLPGMVVMAAAD
FT                   EAELVHMVATAAAHDEGPIAFRYPRGEGTGVEMPERGEVLVIGKGRVMAEGKGVAILSF
FT                   GTRLSEVMRARESLAARGVSPTVVDARFAKPLDRDLILRLARTHEALITIEEGAVGGFG
FT                   SLVAQLLADEGVFDGGLRFRQMVLPDTFIDHASPEAMYREARMSAPDIEAKVLEVLGVA
FT                   LAKRA"
     MTHETSDRPS TPILDRVHLP SDLKDLTDRE LRQLADELRA ETVSAVSVTG GHLGAGLGVV        60
     ELTVALHAVF DAPRDKIIWD VGHQCYPHKI LTGRRDRIRT LRMEGGLSGF TKRSESPYDP       120
     FGAGHSSTSI SAALGFAMAR ELGGDPGDAI AVIGDGAMSA GMAFEALNNA GDLGKRLFVV       180
     LNDNEMSIAP PTGALSRYLT RLYAEGPFQD LKAVAKGAVG FLPPTLQEGA RRAKEMLKGM       240
     TVGGTLFEEL GFSYIGPVDG HDLDQLLPLL RTVKARATGP VLLHVVTRKG KGYGPAERAA       300
     DKGHATAKFD VETGAQAKAK SNAPSYTSVF ARALVDQASR DARIVAVTAA MPDGTGLNLM       360
     AERFPRRCFD VGIAEQHAVT FSAGLAAGGM KPFCALYSTF LQRGYDQVVH DVAIQRLPVR       420
     FAIDRAGLVG ADGATHAGAY DVAFLANLPG MVVMAAADEA ELVHMVATAA AHDEGPIAFR       480
     YPRGEGTGVE MPERGEVLVI GKGRVMAEGK GVAILSFGTR LSEVMRARES LAARGVSPTV       540
     VDARFAKPLD RDLILRLART HEALITIEEG AVGGFGSLVA QLLADEGVFD GGLRFRQMVL       600
     PDTFIDHASP EAMYREARMS APDIEAKVLE VLGVALAKRA                             640
//

If you have problems or comments...

PBIL Back to PBIL home page