(data stored in ACNUC7421 zone)

EMBL: CP000489.PE40

CP000489.PE40        Location/Qualifiers
FT   CDS             complement(32750..32947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0040"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="TIGRFAM: thiamine biosynthesis protein ThiS; PFAM:
FT                   thiamineS protein; KEGG: bmb:BruAb1_0211 thiamine
FT                   biosynthesis ThiS"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68157"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY13"
FT                   /protein_id="ABL68157.1"
FT                   /translation="MKITLNGAARDLTGPTVQDALAEIGLGAAKVATALNGAFLPAAAR
FT                   PETTLKDGDALEVVAPMQGG"
     MKITLNGAAR DLTGPTVQDA LAEIGLGAAK VATALNGAFL PAAARPETTL KDGDALEVVA        60
     PMQGG                                                                    65
//

If you have problems or comments...

PBIL Back to PBIL home page