(data stored in ACNUC7421 zone)

EMBL: CP000489.PE400

CP000489.PE400       Location/Qualifiers
FT   CDS             complement(372855..373841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0403"
FT                   /product="luciferase family protein"
FT                   /note="PFAM: luciferase family protein; KEGG: sil:SPO2518
FT                   bacterial luciferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68517"
FT                   /db_xref="GOA:A1AZ23"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019949"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ23"
FT                   /protein_id="ABL68517.1"
FT                   /translation="MEFSVLDLAVVAEGSDARQAIANSVALAQAAEGWGYSRFWLAEHH
FT                   NMPGIASAATAVLIGHVADHTRAIRVGAGGVMLPNHAPLAIAEQFGTLATIHGPRIDLG
FT                   LGRAPGGDGAVMHALRRSMQRNEDFPNDVVELLRYLGPPRPGAPVAAHPGEGTNVPVWI
FT                   LGSSLYGASLAAALGLPYAFASHFAPGDLEEARRLYRERFQPTEFGEKPRFMLAVNVIA
FT                   AETDAEAQRLRSSQQISFARLRLGMPGLLPPPVDDVLDAIPVRILPTVNAALAISAVGS
FT                   PQTVAAELDRLIARHQPDELILVGNIYDQVARHRSFAIAAEILRGRT"
     MEFSVLDLAV VAEGSDARQA IANSVALAQA AEGWGYSRFW LAEHHNMPGI ASAATAVLIG        60
     HVADHTRAIR VGAGGVMLPN HAPLAIAEQF GTLATIHGPR IDLGLGRAPG GDGAVMHALR       120
     RSMQRNEDFP NDVVELLRYL GPPRPGAPVA AHPGEGTNVP VWILGSSLYG ASLAAALGLP       180
     YAFASHFAPG DLEEARRLYR ERFQPTEFGE KPRFMLAVNV IAAETDAEAQ RLRSSQQISF       240
     ARLRLGMPGL LPPPVDDVLD AIPVRILPTV NAALAISAVG SPQTVAAELD RLIARHQPDE       300
     LILVGNIYDQ VARHRSFAIA AEILRGRT                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page