(data stored in ACNUC7421 zone)

EMBL: CP000489.PE402

CP000489.PE402       Location/Qualifiers
FT   CDS             375573..375872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0405"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: rsp:RSP_1388 DNA-binding protein HU, form N"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68519"
FT                   /db_xref="GOA:A1AZ25"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ25"
FT                   /protein_id="ABL68519.1"
FT                   /translation="MAQAASKPMTKTQLVATLADEMGSDKKTAAAALDALSAVVSRTVA
FT                   EGGALTLPGIGKVACRTRPERQVRNPQTQEMMTKPADKVVKVTIAKALKDSVNA"
     MAQAASKPMT KTQLVATLAD EMGSDKKTAA AALDALSAVV SRTVAEGGAL TLPGIGKVAC        60
     RTRPERQVRN PQTQEMMTKP ADKVVKVTIA KALKDSVNA                               99
//

If you have problems or comments...

PBIL Back to PBIL home page