(data stored in ACNUC7421 zone)

EMBL: CP000489.PE405

CP000489.PE405       Location/Qualifiers
FT   CDS             377546..378247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0408"
FT                   /product="Helix-turn-helix, type 11 domain protein"
FT                   /note="PFAM: Helix-turn-helix, type 11 domain protein;
FT                   KEGG: hne:HNE_1222 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68522"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ28"
FT                   /protein_id="ABL68522.1"
FT                   /translation="MSRTDRLMRLMDALRRLPAPVTAARLAEETGVSRRQLYRDIATLR
FT                   AGGALIDGEAGLGYALTEDPALPPQSFSRLEIEALLLAISGLRTLGDPELTRAGEDALA
FT                   RIIATLPESQGRHAMHTTMRLFRAPAQRPSPQVDMALLRAALWEERSLVIDYLDLHDAA
FT                   TTREIWPLGLSYSDNHMMLLAHCKLREDFRTFHVPRIRAMRPGGTSFRPRRVALVREYI
FT                   SRPCATRPQSG"
     MSRTDRLMRL MDALRRLPAP VTAARLAEET GVSRRQLYRD IATLRAGGAL IDGEAGLGYA        60
     LTEDPALPPQ SFSRLEIEAL LLAISGLRTL GDPELTRAGE DALARIIATL PESQGRHAMH       120
     TTMRLFRAPA QRPSPQVDMA LLRAALWEER SLVIDYLDLH DAATTREIWP LGLSYSDNHM       180
     MLLAHCKLRE DFRTFHVPRI RAMRPGGTSF RPRRVALVRE YISRPCATRP QSG              233
//

If you have problems or comments...

PBIL Back to PBIL home page