(data stored in ACNUC7421 zone)

EMBL: CP000489.PE408

CP000489.PE408       Location/Qualifiers
FT   CDS             380224..381213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0411"
FT                   /product="putative exonuclease protein involved in mRNA
FT                   processing"
FT                   /note="KEGG: ret:RHE_CH01163 putative exonuclease protein
FT                   involved in mRNA processing"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68525"
FT                   /db_xref="GOA:A1AZ31"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR026360"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ31"
FT                   /protein_id="ABL68525.1"
FT                   /translation="MRADSILFPTEAGLFCPEGGFHIDPLKPVERALITHGHSDHARFG
FT                   HGAVMATAETLEIMRLRMGDGFAGATQVADGEMRIGGVTVGFHPAGHVLGSSQIAVEAG
FT                   GRRIVVSGDYARQPNPTCAPFQPVPCDVFVTEATFGLPVFRFPDPTTQVVKLLSSMAEF
FT                   PDRPHLIGAYALGKAQHVIALMREAGYDAPIAIHGALKVLCDFYAARGVELGELVPATA
FT                   EDVAAQLVIAPPSAFASPWVQRFRDPVIGFASGWMAVRARARQRGVELPLVISDHVDWP
FT                   ALTGTLAELAPSEVWVTHGAEDGVIRWCELAQIPARPLRLVGYEDEAE"
     MRADSILFPT EAGLFCPEGG FHIDPLKPVE RALITHGHSD HARFGHGAVM ATAETLEIMR        60
     LRMGDGFAGA TQVADGEMRI GGVTVGFHPA GHVLGSSQIA VEAGGRRIVV SGDYARQPNP       120
     TCAPFQPVPC DVFVTEATFG LPVFRFPDPT TQVVKLLSSM AEFPDRPHLI GAYALGKAQH       180
     VIALMREAGY DAPIAIHGAL KVLCDFYAAR GVELGELVPA TAEDVAAQLV IAPPSAFASP       240
     WVQRFRDPVI GFASGWMAVR ARARQRGVEL PLVISDHVDW PALTGTLAEL APSEVWVTHG       300
     AEDGVIRWCE LAQIPARPLR LVGYEDEAE                                         329
//

If you have problems or comments...

PBIL Back to PBIL home page