(data stored in ACNUC7421 zone)

EMBL: CP000489.PE409

CP000489.PE409       Location/Qualifiers
FT   CDS             381210..382754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0412"
FT                   /product="ATP dependent DNA ligase"
FT                   /note="PFAM: ATP dependent DNA ligase domain protein; ATP
FT                   dependent DNA ligase; KEGG: ccr:CC3610 DNA ligase,
FT                   ATP-dependent, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68526"
FT                   /db_xref="GOA:A1AZ32"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR026333"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ32"
FT                   /protein_id="ABL68526.1"
FT                   /translation="MKAFAALLERLAFTPARNAKLQLLQHYLERTPDPDRGWALAALTG
FT                   DLELRRVTPSLLRGLAAERVDGELLALSYDFVGDLAETIALLWPEGAEDDPSLSQAVAL
FT                   LQGTGKAALPGAIAGMLDRLGPSERLAFLKLATGNLRIGVSARMARTALAGMGVPSVPE
FT                   IEEIWHGLAPPYAPLFGWLGGGARPESAALAPFRPVMLSTPTDLDELRALDPGDYLAEW
FT                   KWDGIRVQAVSEGGMRRLYSRTGEDISHAFPDVIEAMDFDGTADGELIVRREGEVAPFG
FT                   DLQKRLNRKTVGKGLLASHPAGLRLYDLLLWDGRDLRAEPLGARRTVLEAVDFGPRIDI
FT                   SPLLDFATWEDLAALRAEPPAAVIEGVMIKRRDSAYVAGRPRGPWFKWKRDPMVVDAVL
FT                   IYAQRGHGKRSGFHSDFTFGLWDGGELVPVGKAYFGFTDAELRELDRFVRQNTVERYGP
FT                   VRALAPKLVVEVAFEGLNRSTRHRSGVAMRFPRISRIRWDKPAAEADRLETLEAML"
     MKAFAALLER LAFTPARNAK LQLLQHYLER TPDPDRGWAL AALTGDLELR RVTPSLLRGL        60
     AAERVDGELL ALSYDFVGDL AETIALLWPE GAEDDPSLSQ AVALLQGTGK AALPGAIAGM       120
     LDRLGPSERL AFLKLATGNL RIGVSARMAR TALAGMGVPS VPEIEEIWHG LAPPYAPLFG       180
     WLGGGARPES AALAPFRPVM LSTPTDLDEL RALDPGDYLA EWKWDGIRVQ AVSEGGMRRL       240
     YSRTGEDISH AFPDVIEAMD FDGTADGELI VRREGEVAPF GDLQKRLNRK TVGKGLLASH       300
     PAGLRLYDLL LWDGRDLRAE PLGARRTVLE AVDFGPRIDI SPLLDFATWE DLAALRAEPP       360
     AAVIEGVMIK RRDSAYVAGR PRGPWFKWKR DPMVVDAVLI YAQRGHGKRS GFHSDFTFGL       420
     WDGGELVPVG KAYFGFTDAE LRELDRFVRQ NTVERYGPVR ALAPKLVVEV AFEGLNRSTR       480
     HRSGVAMRFP RISRIRWDKP AAEADRLETL EAML                                   514
//

If you have problems or comments...

PBIL Back to PBIL home page