(data stored in ACNUC7421 zone)

EMBL: CP000489.PE410

CP000489.PE410       Location/Qualifiers
FT   CDS             382751..385186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0413"
FT                   /product="DEAD/H associated domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; DEAD/H associated domain protein;
FT                   SMART: DEAD-like helicases-like; KEGG: rsp:RSP_0658
FT                   probable ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68527"
FT                   /db_xref="GOA:A1AZ33"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013701"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR017170"
FT                   /db_xref="InterPro:IPR026362"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ33"
FT                   /protein_id="ABL68527.1"
FT                   /translation="MILPPEFQDWFVRQGWQPHPHQLALLAAEGDSLLIAPTGGGKTLA
FT                   GFLPSLVDLARVGRSQDGYLENGKGARTGLHTLYVSPLKALTADIGRNLARPVAELGLE
FT                   IRVEDRTGDTGQGQRRRQRVDPPEILLTTPESLALMLSYPEAPAIFGGLRRVVLDELHA
FT                   LAESKRGDQLMLGLARLRRLAPGLRVTGLSATVEDPQALAGFMAGAALVTVVEADPGPD
FT                   PDIAMLPTAKPAPWSGGGGHYAIPEVLEAVKGARTTIIFINTRAQAELFFQALWAENDE
FT                   NLPIGLHHGSLAREQRARVEAAMAAGELRAVVATGSLDLGIDWGAVDLVIQVGAPKNVK
FT                   RLVQRIGRANHRYNAPSRARIVPANRFEQIECVAALEAVRERDLDGDRRGPGPLDVLCQ
FT                   HIGLTACAAPFDADALFAEVVTAGPYRGLSRADFDACLDFAATGGYALRAYDRWQRLVL
FT                   RAGLWQLRDPRAAKLLRMNVGTIVEAEMMKVRLRGRGGAPLGEVEEAFAASLTHGDSFL
FT                   IGGRVVRMDAMREMVIEVTPDPTRQPKIAVYSGVKLAMSTQLSHRVLALIGDPARHGAL
FT                   PAQTREWLDLQAQVSALPEPGLLLSESFPHAGLWHFALYGFAGRNALQTLGLLLTREME
FT                   DEGLGPLGFLSTDYALLVWSLDAVRDPAPLLDRARLRAGLGDWLGENAVMKRTFRNVAT
FT                   VAGLTQRNMPGQRKTGRQATFSSDILYDTLRKYDPGHLMLRITAEEAGRGLVDFGRIEE
FT                   MLDRSPRREHRMLERVSPMAAPLLLEVGRVPIRGEGRERLAQIEAEALMAEAGLEGIA"
     MILPPEFQDW FVRQGWQPHP HQLALLAAEG DSLLIAPTGG GKTLAGFLPS LVDLARVGRS        60
     QDGYLENGKG ARTGLHTLYV SPLKALTADI GRNLARPVAE LGLEIRVEDR TGDTGQGQRR       120
     RQRVDPPEIL LTTPESLALM LSYPEAPAIF GGLRRVVLDE LHALAESKRG DQLMLGLARL       180
     RRLAPGLRVT GLSATVEDPQ ALAGFMAGAA LVTVVEADPG PDPDIAMLPT AKPAPWSGGG       240
     GHYAIPEVLE AVKGARTTII FINTRAQAEL FFQALWAEND ENLPIGLHHG SLAREQRARV       300
     EAAMAAGELR AVVATGSLDL GIDWGAVDLV IQVGAPKNVK RLVQRIGRAN HRYNAPSRAR       360
     IVPANRFEQI ECVAALEAVR ERDLDGDRRG PGPLDVLCQH IGLTACAAPF DADALFAEVV       420
     TAGPYRGLSR ADFDACLDFA ATGGYALRAY DRWQRLVLRA GLWQLRDPRA AKLLRMNVGT       480
     IVEAEMMKVR LRGRGGAPLG EVEEAFAASL THGDSFLIGG RVVRMDAMRE MVIEVTPDPT       540
     RQPKIAVYSG VKLAMSTQLS HRVLALIGDP ARHGALPAQT REWLDLQAQV SALPEPGLLL       600
     SESFPHAGLW HFALYGFAGR NALQTLGLLL TREMEDEGLG PLGFLSTDYA LLVWSLDAVR       660
     DPAPLLDRAR LRAGLGDWLG ENAVMKRTFR NVATVAGLTQ RNMPGQRKTG RQATFSSDIL       720
     YDTLRKYDPG HLMLRITAEE AGRGLVDFGR IEEMLDRSPR REHRMLERVS PMAAPLLLEV       780
     GRVPIRGEGR ERLAQIEAEA LMAEAGLEGI A                                      811
//

If you have problems or comments...

PBIL Back to PBIL home page