(data stored in ACNUC7421 zone)

EMBL: CP000489.PE412

CP000489.PE412       Location/Qualifiers
FT   CDS             complement(385901..386668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0415"
FT                   /product="outer membrane protein"
FT                   /note="KEGG: mlo:mll1390 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68529"
FT                   /db_xref="GOA:A1AZ35"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ35"
FT                   /protein_id="ABL68529.1"
FT                   /translation="MCAVLVKASLTAGAVASLALGTALAANAGGYTPPVVDTDVTAPVV
FT                   ESAPVGDWAGAYAGLTLGYAFGGDDRVGFTEVDTGTYLGDAGKLELGGANAGLHVGYRW
FT                   QRDRWVFGPELGFEAGNIKDTITFDNQLGGSTDVSSKIRNVLALRLKTGYALRPDLLLY
FT                   GIAGIARADVEYKVAGTDGSGGSMSESRDFKSNGYIVGLGVERKLSDRMSVTGEYEYAN
FT                   FGKTTRTFQVDGGVSTQATPDYHNVKLGLNFKF"
     MCAVLVKASL TAGAVASLAL GTALAANAGG YTPPVVDTDV TAPVVESAPV GDWAGAYAGL        60
     TLGYAFGGDD RVGFTEVDTG TYLGDAGKLE LGGANAGLHV GYRWQRDRWV FGPELGFEAG       120
     NIKDTITFDN QLGGSTDVSS KIRNVLALRL KTGYALRPDL LLYGIAGIAR ADVEYKVAGT       180
     DGSGGSMSES RDFKSNGYIV GLGVERKLSD RMSVTGEYEY ANFGKTTRTF QVDGGVSTQA       240
     TPDYHNVKLG LNFKF                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page