(data stored in ACNUC7421 zone)

EMBL: CP000489.PE413

CP000489.PE413       Location/Qualifiers
FT   CDS             complement(386880..389318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0416"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: rsp:RSP_1346 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase, subunit B domain
FT                   protein; ATP-binding region, ATPase domain protein domain
FT                   protein; TOPRIM domain protein; DNA topoisomerase, type
FT                   IIA, subunit B, region 2 domain protein; SMART: DNA
FT                   topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68530"
FT                   /db_xref="GOA:A1AZ36"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ36"
FT                   /protein_id="ABL68530.1"
FT                   /translation="MTEPAPQTSDYGADSIKVLKGLEAVRKRPGMYIGDTDDGSGLHHM
FT                   VTEVVDNGIDEALAGHADFVRVKIHADGSVSVRDNGRGIPVDMHPTEGVSAAEVIMTQL
FT                   HAGGKFDQNSYKVSGGLHGVGVSVVNALSDWLELRIWRGGKEHYARFENGDTVEHLRVV
FT                   GDAEPGEKGTEVRFLASSKEDRPDGTFLNREYSYKVLENRLRELAFLNSGVRIILEDER
FT                   PAEPLRTELYYEGGVREFVKFIDRSKTPVMPEPIFITGERNGIGIEVAMWWNDSYHETV
FT                   LPFTNNIPQRDGGTHLAGFRGALTRVINNYAQSSGAARKEKVDFTGDDAREGLTCVLSV
FT                   KVPDPKFSSQTKDKLVSSEVRPAVEGLIGEKLAEWFEENPAEAKSILGKIIEAALAREA
FT                   ARKARELTRRKTAMDVASLPGKLADCQEKDPALSELFIVEGDSAGGSAKQGRSRQNQAV
FT                   LPLRGKILNVERARFDRMLSSDQIGTLITALGTGIGRDEFNLDKLRYHKIVIMTDADVD
FT                   GAHIRTLLLTFFFRQMPELIEAGHLYIAQPPLYKVSRGRSEVYLKDEAALEDYLIEQGV
FT                   DGASLRLGNGETLTGADLARVVEEARVVRRILRAYPTHYPPHITEQAAIAGALVQGRVD
FT                   ADAQGVANAVAQRLDMIAEEYERGWTGRPTQDAGIRLTRLLRGVEESRTLDGPMLRSAE
FT                   SRRLGAMTDALRDVYGQTAQLIRKDRGIPIHGPMSLLQAIFLEGEKGLSLQRYKGLGEM
FT                   NPEQLWETTLDPAARTMLQVRVEDLGEADDIFTKLMGDVVEPRRDFIQQNALSVENLDI
FT                   "
     MTEPAPQTSD YGADSIKVLK GLEAVRKRPG MYIGDTDDGS GLHHMVTEVV DNGIDEALAG        60
     HADFVRVKIH ADGSVSVRDN GRGIPVDMHP TEGVSAAEVI MTQLHAGGKF DQNSYKVSGG       120
     LHGVGVSVVN ALSDWLELRI WRGGKEHYAR FENGDTVEHL RVVGDAEPGE KGTEVRFLAS       180
     SKEDRPDGTF LNREYSYKVL ENRLRELAFL NSGVRIILED ERPAEPLRTE LYYEGGVREF       240
     VKFIDRSKTP VMPEPIFITG ERNGIGIEVA MWWNDSYHET VLPFTNNIPQ RDGGTHLAGF       300
     RGALTRVINN YAQSSGAARK EKVDFTGDDA REGLTCVLSV KVPDPKFSSQ TKDKLVSSEV       360
     RPAVEGLIGE KLAEWFEENP AEAKSILGKI IEAALAREAA RKARELTRRK TAMDVASLPG       420
     KLADCQEKDP ALSELFIVEG DSAGGSAKQG RSRQNQAVLP LRGKILNVER ARFDRMLSSD       480
     QIGTLITALG TGIGRDEFNL DKLRYHKIVI MTDADVDGAH IRTLLLTFFF RQMPELIEAG       540
     HLYIAQPPLY KVSRGRSEVY LKDEAALEDY LIEQGVDGAS LRLGNGETLT GADLARVVEE       600
     ARVVRRILRA YPTHYPPHIT EQAAIAGALV QGRVDADAQG VANAVAQRLD MIAEEYERGW       660
     TGRPTQDAGI RLTRLLRGVE ESRTLDGPML RSAESRRLGA MTDALRDVYG QTAQLIRKDR       720
     GIPIHGPMSL LQAIFLEGEK GLSLQRYKGL GEMNPEQLWE TTLDPAARTM LQVRVEDLGE       780
     ADDIFTKLMG DVVEPRRDFI QQNALSVENL DI                                     812
//

If you have problems or comments...

PBIL Back to PBIL home page