(data stored in ACNUC7421 zone)

EMBL: CP000489.PE415

CP000489.PE415       Location/Qualifiers
FT   CDS             complement(389833..390744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0418"
FT                   /product="GTP-binding protein Era"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein Era; PFAM: GTP-binding protein, HSR1-related; KH,
FT                   type 2 domain protein; Miro domain protein; KEGG:
FT                   rsp:RSP_1676 GTP-binding protein Era"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68532"
FT                   /db_xref="GOA:A1AZ38"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ38"
FT                   /protein_id="ABL68532.1"
FT                   /translation="MTQTRAGFVALIGEPNAGKSTLLNRMVGAKVSIVTHKVQTTRARI
FT                   RGIAMRGASQIVFVDTPGIFRPRRRLDRSMVKAAWGGAADADVILLLIEAHRGLTDGTQ
FT                   AIIDNLRDHAGTTPVVLVINKIDRVKSETLLALSQQVNAAFDFTRTFMISAEKGHGCDD
FT                   LLEWLAGQVPEGPWLYPEDQVADLPMRMIAAEITREKLTLRLHEEIPYQLTVETERWEE
FT                   KKDGSARVDQIVYVARPGHKGIVLGKGGETIKAVGQAARAELAEFMGRPVHLFLQVKVR
FT                   ENWLDEAERYNEMGLDFRDGDA"
     MTQTRAGFVA LIGEPNAGKS TLLNRMVGAK VSIVTHKVQT TRARIRGIAM RGASQIVFVD        60
     TPGIFRPRRR LDRSMVKAAW GGAADADVIL LLIEAHRGLT DGTQAIIDNL RDHAGTTPVV       120
     LVINKIDRVK SETLLALSQQ VNAAFDFTRT FMISAEKGHG CDDLLEWLAG QVPEGPWLYP       180
     EDQVADLPMR MIAAEITREK LTLRLHEEIP YQLTVETERW EEKKDGSARV DQIVYVARPG       240
     HKGIVLGKGG ETIKAVGQAA RAELAEFMGR PVHLFLQVKV RENWLDEAER YNEMGLDFRD       300
     GDA                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page