(data stored in ACNUC7421 zone)

EMBL: CP000489.PE416

CP000489.PE416       Location/Qualifiers
FT   CDS             complement(390741..391466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0419"
FT                   /product="RNAse III"
FT                   /EC_number="3.1.26.3"
FT                   /note="PFAM: ribonuclease III; double-stranded RNA binding
FT                   domain protein; KEGG: rsp:RSP_1675 ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68533"
FT                   /db_xref="GOA:A1AZ39"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ39"
FT                   /protein_id="ABL68533.1"
FT                   /translation="MPRRPAPWQDRHMKISADLRAFSERLGHEFSRPELLRRALTHGSI
FT                   ASTTRPDNQRLEFLGDRVLGLTIAEALFSADRAATEGQLAPRYNALVKGETCAAIAREI
FT                   GLGEVLKLGRSEMMSGGRRKEALLADAMEAVIAAVYLDAGFETARGVVLGLWSDRLANV
FT                   ETDARDAKTALQEWAQAQGMSPPRYVQIARTGPDHAPEFQITVRLDDGREASASGKGTK
FT                   RSIEQAAATAMLEQIERTP"
     MPRRPAPWQD RHMKISADLR AFSERLGHEF SRPELLRRAL THGSIASTTR PDNQRLEFLG        60
     DRVLGLTIAE ALFSADRAAT EGQLAPRYNA LVKGETCAAI AREIGLGEVL KLGRSEMMSG       120
     GRRKEALLAD AMEAVIAAVY LDAGFETARG VVLGLWSDRL ANVETDARDA KTALQEWAQA       180
     QGMSPPRYVQ IARTGPDHAP EFQITVRLDD GREASASGKG TKRSIEQAAA TAMLEQIERT       240
     P                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page