(data stored in ACNUC7421 zone)

EMBL: CP000489.PE418

CP000489.PE418       Location/Qualifiers
FT   CDS             complement(392326..392745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0421"
FT                   /product="holo-acyl-carrier-protein synthase"
FT                   /note="TIGRFAM: holo-acyl-carrier-protein synthase; PFAM:
FT                   4'-phosphopantetheinyl transferase; KEGG: rde:RD1_1364
FT                   holo-(acyl-carrier-protein) synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68535"
FT                   /db_xref="GOA:A1AZ41"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZ41"
FT                   /protein_id="ABL68535.1"
FT                   /translation="MILGIGSDLCNIDRIAGVLERHGDRFRRRVFTETELALAGRRRHE
FT                   AATLAKRWAAKEACSKALGTGLAMGISWKDMAVRNLRGGQPTMELTGWAAERLAAMTPP
FT                   GHRAHVHVTLTDDHPWAQAFVVIEALPDDAQAGTA"
     MILGIGSDLC NIDRIAGVLE RHGDRFRRRV FTETELALAG RRRHEAATLA KRWAAKEACS        60
     KALGTGLAMG ISWKDMAVRN LRGGQPTMEL TGWAAERLAA MTPPGHRAHV HVTLTDDHPW       120
     AQAFVVIEAL PDDAQAGTA                                                    139
//

If you have problems or comments...

PBIL Back to PBIL home page