(data stored in ACNUC7421 zone)

EMBL: CP000489.PE42

CP000489.PE42        Location/Qualifiers
FT   CDS             complement(33905..34759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0042"
FT                   /product="hydroxymethylpyrimidine kinase /
FT                   phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="KEGG: sil:SPO0045 phosphomethylpyrimidine kinase;
FT                   TIGRFAM: phosphomethylpyrimidine kinase; PFAM:
FT                   Phosphomethylpyrimidine kinase type-1"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68159"
FT                   /db_xref="GOA:A1AY15"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A1AY15"
FT                   /protein_id="ABL68159.1"
FT                   /translation="MPGRNERRAMSGLQPHPIALTIAGSDSGGGAGIQADLKTFSALGV
FT                   YGASVITAITAQNTRTVAAVEPVSPAMVAAQIDAVFGDLEVRAIKIGMVGGVDAITVVA
FT                   DRLAALLADNPVPVVLDPVMVAKSGDALLPDEAVSALREQLIPLATVLTPNLPEAARLL
FT                   DREPAATPEEMRRQGEALRALGAAHVLMKGGHATEDTCTDLLVGSEPLILTAPRQQTHN
FT                   THGTGCSLSSAIAAGLAQGLTVAQAATRAHGWLQGAIARADELAVGLGHGPVHHFHQLW
FT                   RQA"
     MPGRNERRAM SGLQPHPIAL TIAGSDSGGG AGIQADLKTF SALGVYGASV ITAITAQNTR        60
     TVAAVEPVSP AMVAAQIDAV FGDLEVRAIK IGMVGGVDAI TVVADRLAAL LADNPVPVVL       120
     DPVMVAKSGD ALLPDEAVSA LREQLIPLAT VLTPNLPEAA RLLDREPAAT PEEMRRQGEA       180
     LRALGAAHVL MKGGHATEDT CTDLLVGSEP LILTAPRQQT HNTHGTGCSL SSAIAAGLAQ       240
     GLTVAQAATR AHGWLQGAIA RADELAVGLG HGPVHHFHQL WRQA                        284
//

If you have problems or comments...

PBIL Back to PBIL home page