(data stored in ACNUC7421 zone)

EMBL: CP000489.PE420

CP000489.PE420       Location/Qualifiers
FT   CDS             complement(393559..394380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0423"
FT                   /product="4-diphosphocytidyl-2-C-methyl-D-erythritol
FT                   kinase"
FT                   /EC_number="2.7.1.148"
FT                   /note="KEGG: rsp:RSP_1779 putative
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; TIGRFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol kinase; PFAM:
FT                   GHMP kinase; GHMP kinase, C terminal domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68537"
FT                   /db_xref="GOA:A1AZ43"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZ43"
FT                   /protein_id="ABL68537.1"
FT                   /translation="MPLHRREAAPAKLNLTLHVTGRRVDGYHLLDSLVVFLDLGDVVTI
FT                   APGPLSLSLTGPFAPGLAAEPDNLCLRAARLAGREARITLEKNLPVASGIGGGSADAAA
FT                   VLRALDASPRRPEALGADVPVCLASRPVRMRGVGEILAPLPALPELNVLLVNPGRGLST
FT                   PAVFKALARHDNPPMPEPLPDFPDAQALIGFLHECRNDLEAPAIALMPGIADCLAALRS
FT                   AGAQLARMSGSGATCFGLFASAAEAQAARARIAGTNPGWWVAASGLAPAKH"
     MPLHRREAAP AKLNLTLHVT GRRVDGYHLL DSLVVFLDLG DVVTIAPGPL SLSLTGPFAP        60
     GLAAEPDNLC LRAARLAGRE ARITLEKNLP VASGIGGGSA DAAAVLRALD ASPRRPEALG       120
     ADVPVCLASR PVRMRGVGEI LAPLPALPEL NVLLVNPGRG LSTPAVFKAL ARHDNPPMPE       180
     PLPDFPDAQA LIGFLHECRN DLEAPAIALM PGIADCLAAL RSAGAQLARM SGSGATCFGL       240
     FASAAEAQAA RARIAGTNPG WWVAASGLAP AKH                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page