(data stored in ACNUC7421 zone)

EMBL: CP000489.PE421

CP000489.PE421       Location/Qualifiers
FT   CDS             complement(394384..396312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0424"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: rde:RD1_3403 TPR
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68538"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ44"
FT                   /protein_id="ABL68538.1"
FT                   /translation="MIAAGHAAPAAALPIGAAAARVAGAIAETWAQAVTTRLIPLALIA
FT                   LLPLLQGPAMAAPSLAQAQDPAAGNSERPAHRPVDAAPDLRGLSGPYLAARMAAIQNDY
FT                   SVAARYYLQALAHDDSDPFLQDSALVALISAGEMERAAALSGTMSDQGRATELARLVQR
FT                   AEMARAGRWDALIEAIDSAPSPGGNATPGGGILVDGMMRAWALLGAGKAGESLTAFKKL
FT                   AELRGAAPMVNYHLALAKARVGDFEGAELLLADPATGAHILGVIARAQVLSQLERNRDA
FT                   IAMLEATPGFAEEPYLVALRDRMKRGETLPFDSARGPADGMAQVFLTFGSVLATSDEPD
FT                   PLALIHARLAEYLAPDLGEARLLSAQLLQGFGQFDLAEHEFEALRELGDMRPVAELSRI
FT                   DALARAERLNDAEKAALALTAAHPELAQGWIALGDMLRQQDKFGQAVPAYDKALSLIGD
FT                   KIPEARWFPLYARGIALERSGQFSKAEADFRAALKIRPDSAQVLNYLGYSLVDRSEKLD
FT                   EALALIQRAVELRPDDGYILDSLAWAYFRLDRYPEAVAPMERAVAAMPGDPLVNDHMGD
FT                   IYWMVGRKREAEIQWHRALSLKPETEAEVHRIRAKLERGLDAVLEEEKANGGKLPEVRA
FT                   PEPARAD"
     MIAAGHAAPA AALPIGAAAA RVAGAIAETW AQAVTTRLIP LALIALLPLL QGPAMAAPSL        60
     AQAQDPAAGN SERPAHRPVD AAPDLRGLSG PYLAARMAAI QNDYSVAARY YLQALAHDDS       120
     DPFLQDSALV ALISAGEMER AAALSGTMSD QGRATELARL VQRAEMARAG RWDALIEAID       180
     SAPSPGGNAT PGGGILVDGM MRAWALLGAG KAGESLTAFK KLAELRGAAP MVNYHLALAK       240
     ARVGDFEGAE LLLADPATGA HILGVIARAQ VLSQLERNRD AIAMLEATPG FAEEPYLVAL       300
     RDRMKRGETL PFDSARGPAD GMAQVFLTFG SVLATSDEPD PLALIHARLA EYLAPDLGEA       360
     RLLSAQLLQG FGQFDLAEHE FEALRELGDM RPVAELSRID ALARAERLND AEKAALALTA       420
     AHPELAQGWI ALGDMLRQQD KFGQAVPAYD KALSLIGDKI PEARWFPLYA RGIALERSGQ       480
     FSKAEADFRA ALKIRPDSAQ VLNYLGYSLV DRSEKLDEAL ALIQRAVELR PDDGYILDSL       540
     AWAYFRLDRY PEAVAPMERA VAAMPGDPLV NDHMGDIYWM VGRKREAEIQ WHRALSLKPE       600
     TEAEVHRIRA KLERGLDAVL EEEKANGGKL PEVRAPEPAR AD                          642
//

If you have problems or comments...

PBIL Back to PBIL home page