(data stored in ACNUC7421 zone)

EMBL: CP000489.PE422

CP000489.PE422       Location/Qualifiers
FT   CDS             complement(396309..397955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0425"
FT                   /product="Electron-transferring-flavoprotein dehydrogenase"
FT                   /EC_number="1.5.5.1"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   electron transfer flavoprotein-ubiquinone oxidoreductase;
FT                   KEGG: sil:SPO0316 electrotransfer ubiquinone oxidoreductase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68539"
FT                   /db_xref="GOA:A1AZ45"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ45"
FT                   /protein_id="ABL68539.1"
FT                   /translation="MSEIERESMDYDVVIVGGGPAGLSAAIRLKQVNPELSVVLLEKGS
FT                   EIGAHILSGAVLDTSGLDRLIPDWKDRGAPVTTEVTQDNFYILGPHGQVRVPNWPMPPL
FT                   MNNHGKYIVSMGNVCRWLAEQAEALEVEIFPGMACSQLVYEGDRVVGVVAGEMGLNADG
FT                   SPGPAYEPGMELRGKYVLIAEGVRGSLAKELIGKYDLSAGHEPQKFGLGMKEIWEIDPA
FT                   KARPGTVTHTMGWPLGKNAGGGSFIYHLEGNQVLVGFVVHLNYANPYLYPYMEFQRFKH
FT                   HPLVADLLEGGKRVAYGARAISEGGWQSIPKLTVPGAALLGCSAGLVNVPRIKGNHNAM
FT                   LSGIAAAEAAAKAIAAGREGDELTDYEADLRSGPIARDLKPVRNVKPLWSKLGLWSSLV
FT                   LGGFDMWVANLTGWNPLGTWKHGKTDAQATGKAADFQPIDYPRPDGKLSFDRLTNVAFS
FT                   FTNHEESQPCHLKLKDPAVPIAVNLPLYAEPATRYCPAGVYEVLEGEGGPRFQINFQNC
FT                   VHCKTCDIKDPSQNINWTTPQGGDGPNYPNM"
     MSEIERESMD YDVVIVGGGP AGLSAAIRLK QVNPELSVVL LEKGSEIGAH ILSGAVLDTS        60
     GLDRLIPDWK DRGAPVTTEV TQDNFYILGP HGQVRVPNWP MPPLMNNHGK YIVSMGNVCR       120
     WLAEQAEALE VEIFPGMACS QLVYEGDRVV GVVAGEMGLN ADGSPGPAYE PGMELRGKYV       180
     LIAEGVRGSL AKELIGKYDL SAGHEPQKFG LGMKEIWEID PAKARPGTVT HTMGWPLGKN       240
     AGGGSFIYHL EGNQVLVGFV VHLNYANPYL YPYMEFQRFK HHPLVADLLE GGKRVAYGAR       300
     AISEGGWQSI PKLTVPGAAL LGCSAGLVNV PRIKGNHNAM LSGIAAAEAA AKAIAAGREG       360
     DELTDYEADL RSGPIARDLK PVRNVKPLWS KLGLWSSLVL GGFDMWVANL TGWNPLGTWK       420
     HGKTDAQATG KAADFQPIDY PRPDGKLSFD RLTNVAFSFT NHEESQPCHL KLKDPAVPIA       480
     VNLPLYAEPA TRYCPAGVYE VLEGEGGPRF QINFQNCVHC KTCDIKDPSQ NINWTTPQGG       540
     DGPNYPNM                                                                548
//

If you have problems or comments...

PBIL Back to PBIL home page