(data stored in ACNUC7421 zone)

EMBL: CP000489.PE423

CP000489.PE423       Location/Qualifiers
FT   CDS             398232..398702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0426"
FT                   /product="transcription elongation factor GreA"
FT                   /note="TIGRFAM: transcription elongation factor GreA; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein;
FT                   KEGG: rsp:RSP_1776 transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68540"
FT                   /db_xref="GOA:A1AZ46"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZ46"
FT                   /protein_id="ABL68540.1"
FT                   /translation="MEKIPMTRAGYDQLDEELRELRSVQRPAVIRAIAEAREHGDLSEN
FT                   AEYHAAREKQSFVEGRIKELEMILSRAEVIDPTRLNGSIKFGATVTLVDEDSEEERTYQ
FT                   IVGEAEADLERGLLNIRSPLARALIGKDEGDSIEVVTPGGGKSYEIISIRYV"
     MEKIPMTRAG YDQLDEELRE LRSVQRPAVI RAIAEAREHG DLSENAEYHA AREKQSFVEG        60
     RIKELEMILS RAEVIDPTRL NGSIKFGATV TLVDEDSEEE RTYQIVGEAE ADLERGLLNI       120
     RSPLARALIG KDEGDSIEVV TPGGGKSYEI ISIRYV                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page