(data stored in ACNUC7421 zone)

EMBL: CP000489.PE426

CP000489.PE426       Location/Qualifiers
FT   CDS             400357..401133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0429"
FT                   /product="AzlC family protein"
FT                   /note="PFAM: AzlC family protein; KEGG: rsp:RSP_0739
FT                   branched chain amino acid efflux pump, large (AzlC)
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68543"
FT                   /db_xref="GOA:A1AZ49"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ49"
FT                   /protein_id="ABL68543.1"
FT                   /translation="MTAQADLAADSCLTPEQSRALRRKPAQCVRHGFVQALPFILVLLP
FT                   FGMLFGVVATDAGLDLPQILGFTVLVLAGASQFTAVQLMTDHAPALVIIVSAIAVNLRM
FT                   AMYSASLVPWLGRARPRDRAWIAYVLVDQSYALAIQHYEKHPRLNLEQRIGYFLGAVLA
FT                   TCPIWLLATLLGVWLGQAIPEDWALDFAMPITFLALIAPMLRSPAHLAAALVAVVGSLV
FT                   FAFLPSGLGLFVAAPLAMLTGAGVEVLMERRNGARL"
     MTAQADLAAD SCLTPEQSRA LRRKPAQCVR HGFVQALPFI LVLLPFGMLF GVVATDAGLD        60
     LPQILGFTVL VLAGASQFTA VQLMTDHAPA LVIIVSAIAV NLRMAMYSAS LVPWLGRARP       120
     RDRAWIAYVL VDQSYALAIQ HYEKHPRLNL EQRIGYFLGA VLATCPIWLL ATLLGVWLGQ       180
     AIPEDWALDF AMPITFLALI APMLRSPAHL AAALVAVVGS LVFAFLPSGL GLFVAAPLAM       240
     LTGAGVEVLM ERRNGARL                                                     258
//

If you have problems or comments...

PBIL Back to PBIL home page