(data stored in ACNUC7421 zone)

EMBL: CP000489.PE429

CP000489.PE429       Location/Qualifiers
FT   CDS             complement(402118..402318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0432"
FT                   /product="aa3 type cytochrome c oxidase subunit IV"
FT                   /note="PFAM: aa3 type cytochrome c oxidase subunit IV;
FT                   KEGG: rsp:RSP_6128 Aa3-type cytochrome c oxidase subunit
FT                   IV"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68546"
FT                   /db_xref="GOA:A1AZ52"
FT                   /db_xref="InterPro:IPR012422"
FT                   /db_xref="InterPro:IPR036596"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ52"
FT                   /protein_id="ABL68546.1"
FT                   /translation="MGYPCARRIASFTDRIMASHHEITDHKHGEMDIRHQQATFAGFIK
FT                   GATWVSILSIAVLVFLALANS"
     MGYPCARRIA SFTDRIMASH HEITDHKHGE MDIRHQQATF AGFIKGATWV SILSIAVLVF        60
     LALANS                                                                   66
//

If you have problems or comments...

PBIL Back to PBIL home page