(data stored in ACNUC7421 zone)

EMBL: CP000489.PE430

CP000489.PE430       Location/Qualifiers
FT   CDS             complement(402332..403354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0433"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   rsp:RSP_0741 putative metallo-beta-lactamase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68547"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A1AZ53"
FT                   /protein_id="ABL68547.1"
FT                   /translation="MIRSEAHNPPAEGEAHEIAPGVFWFQLPLPFKPDTVNAYAFRDAD
FT                   GWTVVDTGLDTRRTRAIWQGILQGPLAGAPVVRLIATHHHIDHIGLAGWFQAQGAELWT
FT                   SRASWLMARMGILDVQERPTPQAVAFWRQAGMPPELLDERSHERPFNSADVCAPLPPGY
FT                   RRLSEGQQVTFGERRWVVRMGHGHAPEHVTLWSLDDDLVIGGDQMLATISPNLGVYPTE
FT                   PEADTVGDWLESCDRLAEYARPEQLVLPGHKLPYRGLPTRLRQLATNQRAALDRMLEGL
FT                   RQEPLSTVGCFPLLYRRQIAKPEFGLALAEAVGHVNHLRATGQVWPVGKTETGAVLWGA
FT                   "
     MIRSEAHNPP AEGEAHEIAP GVFWFQLPLP FKPDTVNAYA FRDADGWTVV DTGLDTRRTR        60
     AIWQGILQGP LAGAPVVRLI ATHHHIDHIG LAGWFQAQGA ELWTSRASWL MARMGILDVQ       120
     ERPTPQAVAF WRQAGMPPEL LDERSHERPF NSADVCAPLP PGYRRLSEGQ QVTFGERRWV       180
     VRMGHGHAPE HVTLWSLDDD LVIGGDQMLA TISPNLGVYP TEPEADTVGD WLESCDRLAE       240
     YARPEQLVLP GHKLPYRGLP TRLRQLATNQ RAALDRMLEG LRQEPLSTVG CFPLLYRRQI       300
     AKPEFGLALA EAVGHVNHLR ATGQVWPVGK TETGAVLWGA                             340
//

If you have problems or comments...

PBIL Back to PBIL home page