(data stored in ACNUC7421 zone)

EMBL: CP000489.PE433

CP000489.PE433       Location/Qualifiers
FT   CDS             complement(406113..406685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Pden_0436"
FT                   /product="protein of unknown function DUF179"
FT                   /note="PFAM: protein of unknown function DUF179; KEGG:
FT                   sil:SPO0296 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Pden_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABL68550"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/Swiss-Prot:A1AZ56"
FT                   /protein_id="ABL68550.1"
FT                   /translation="MDQSSNLTGKMLIAMPGMRDPRFEQSVILICAHSEDGAMGLVVNR
FT                   PLPEIGFSDLLAQLGIQAGANALDIPVRFGGPVEPGRGFVLHRAPREIELDENRMRITD
FT                   DLAMSTTRDILEDFARGLGPQPAMLALGYAGWGPGQLDSEIRENGWLTSDRGDEIIFGA
FT                   EDAGKWRAALKSLGIDPLMLSPDAGHA"
     MDQSSNLTGK MLIAMPGMRD PRFEQSVILI CAHSEDGAMG LVVNRPLPEI GFSDLLAQLG        60
     IQAGANALDI PVRFGGPVEP GRGFVLHRAP REIELDENRM RITDDLAMST TRDILEDFAR       120
     GLGPQPAMLA LGYAGWGPGQ LDSEIRENGW LTSDRGDEII FGAEDAGKWR AALKSLGIDP       180
     LMLSPDAGHA                                                              190
//

If you have problems or comments...

PBIL Back to PBIL home page